PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004491125.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family TALE
Protein Properties Length: 311aa    MW: 35908.9 Da    PI: 6.9858
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004491125.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-092412752155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  XP_004491125.1 241 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 275
                     569*****************************885 PP

2ELK38.42.6e-13195216122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLk+EF+
  XP_004491125.1 195 ELKVQLLRKYSGYLGSLKKEFL 216
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.4E-1462106IPR005540KNOX1
PfamPF037907.8E-1964105IPR005540KNOX1
SMARTSM012564.9E-26114165IPR005541KNOX2
PfamPF037917.7E-22118163IPR005541KNOX2
PfamPF037891.9E-9195216IPR005539ELK domain
SMARTSM011887.1E-7195216IPR005539ELK domain
PROSITE profilePS5121311.139195215IPR005539ELK domain
PROSITE profilePS5007112.228215278IPR001356Homeobox domain
SMARTSM003892.8E-12217282IPR001356Homeobox domain
SuperFamilySSF466892.01E-19217289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28220281IPR009057Homeodomain-like
CDDcd000868.01E-13227279No hitNo description
PfamPF059202.7E-17235274IPR008422Homeobox KN domain
PROSITE patternPS000270253276IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MLGFGGNNSF SEFCSMDHHH HPMNIMNINM DTTNRKFHSF PLTTNNSSLQ QHHHNYNNTA  60
NVVVRDKIMA HPLFPRLLSS YLNCLKVGAP PEVVASLEES CAKCETLNGS GRTGSSCLGE  120
DPALDQFMEA YCEMLIKYEQ ELTKPFKEAM LFLSRIESQL KALAVSTDFG QSESPSHNEI  180
DMHENNLDTQ AEDQELKVQL LRKYSGYLGS LKKEFLKKKK NGKLPKEARQ QLLDWWNRHY  240
KWPYPSESQK QALAESTGLD LKQINNWFIN QRKRHWKPSE DMQFAVMDAT NYYMENVMCK  300
PFPMDAMPML L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280610.0EF128061.1 Medicago truncatula class I KNOX homeobox transcription factor (KNOX6) mRNA, complete cds.
GenBankGU4616040.0GU461604.1 Medicago truncatula KNOX6 variant a mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491125.10.0PREDICTED: homeobox protein SBH1-like isoform X1
SwissprotP466081e-118HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA5Y4H11e-169A5Y4H1_MEDTR; Class I KNOX homeobox transcription factor
STRINGGLYMA14G05150.21e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-105KNOX/ELK homeobox transcription factor